| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50402141 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_884722 (CHEMBL2215603) |
|---|
| Ki | 70.7±n/a nM |
|---|
| Citation |  Fujii, H; Nakajima, R; Akiyama, J; Yamamoto, N; Hirayama, S; Nemoto, T; Gouda, H; Hirono, S; Nagase, H Synthesis of new opioid derivatives with a propellane skeleton and their pharmacologies: part 3, novel propellane derivatives with pentacyclic skeletons. Bioorg Med Chem Lett22:7697-701 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50402141 |
|---|
| n/a |
|---|
| Name | BDBM50402141 |
|---|
| Synonyms: | CHEMBL2207681 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H27NO3 |
|---|
| Mol. Mass. | 353.4547 |
|---|
| SMILES | O[C@H]1CC2N(CC3CC3)CCC34CC(=O)C1CC23Cc1ccc(O)cc41 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
