Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIndoleamine 2,3-dioxygenase 1
LigandBDBM50092055
Substrate/Competitorn/a
Meas. Tech.ChEMBL_885589
IC50 59900±n/a nM
Citation Bakmiwewa SMFatokun AATran APayne RJHunt NHBall HJ Identification of selective inhibitors of indoleamine 2,3-dioxygenase 2. Bioorg Med Chem Lett 22:7641-6 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Indoleamine 2,3-dioxygenase 1
Name:Indoleamine 2,3-dioxygenase 1
Synonyms:IDO-1 | Indoleamine-pyrrole 2,3-dioxygenase
Type:PROTEIN
Mol. Mass.:45639.39
Organism:Mus musculus
Description:ChEMBL_1452149
Residue:407
Sequence:
MALSKISPTEGSRRILEDHHIDEDVGFALPHPLVELPDAYSPWVLVARNLPVLIENGQLR
EEVEKLPTLSTDGLRGHRLQRLAHLALGYITMAYVWNRGDDDVRKVLPRNIAVPYCELSE
KLGLPPILSYADCVLANWKKKDPNGPMTYENMDILFSFPGGDCDKGFFLVSLLVEIAASP
AIKAIPTVSSAVERQDLKALEKALHDIATSLEKAKEIFKRMRDFVDPDTFFHVLRIYLSG
WKCSSKLPEGLLYEGVWDTPKMFSGGSAGQSSIFQSLDVLLGIKHEAGKESPAEFLQEMR
EYMPPAHRNFLFFLESAPPVREFVISRHNEDLTKAYNECVNGLVSVRKFHLAIVDTYIMK
PSKKKPTDGDKSEEPSNVESRGTGGTNPMTFLRSVKDTTEKALLSWP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50092055
n/a
NameBDBM50092055
Synonyms:(2E,4E,6E,8E)-3,7-Dimethyl-9-(2,6,6-trimethyl-cyclohex-1-enyl)-nona-2,4,6,8-tetraenoic acid (4-hydroxy-phenyl)-amide | (2E,4E,6E,8E)-N-(4-hydroxyphenyl)-3,7-dimethyl-9-(2,6,6-trimethylcyclohex-1-enyl)nona-2,4,6,8-tetraenamide | 3,7-Dimethyl-9-(2,6,6-trimethyl-cyclohex-1-enyl)-nona-2,4,6,8-tetraenoic acid (4-hydroxy-phenyl)-amide | 4-hydroxyphenyl retinamide | CHEMBL7301 | FENRETINIDE | N-(4-HYDROXYPHENYL)ALL-TRANS RETINAMIDE | N-(4-hydroxyphenyl)-retinamide | N-(4-hydroxyphenyl)retinamide | N-(4-hydroxyphenyl)retinamide, 4-HPR
TypeSmall organic molecule
Emp. Form.C26H33NO2
Mol. Mass.391.5457
SMILESC\C(\C=C\C1=C(C)CCCC1(C)C)=C/C=C/C(/C)=C/C(=O)Nc1ccc(O)cc1 |c:4|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: