Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIndoleamine 2,3-dioxygenase 1
LigandBDBM31883
Substrate/Competitorn/a
Meas. Tech.ChEMBL_885589
IC50 301300±n/a nM
Citation Bakmiwewa SMFatokun AATran APayne RJHunt NHBall HJ Identification of selective inhibitors of indoleamine 2,3-dioxygenase 2. Bioorg Med Chem Lett 22:7641-6 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Indoleamine 2,3-dioxygenase 1
Name:Indoleamine 2,3-dioxygenase 1
Synonyms:IDO-1 | Indoleamine-pyrrole 2,3-dioxygenase
Type:PROTEIN
Mol. Mass.:45639.39
Organism:Mus musculus
Description:ChEMBL_1452149
Residue:407
Sequence:
MALSKISPTEGSRRILEDHHIDEDVGFALPHPLVELPDAYSPWVLVARNLPVLIENGQLR
EEVEKLPTLSTDGLRGHRLQRLAHLALGYITMAYVWNRGDDDVRKVLPRNIAVPYCELSE
KLGLPPILSYADCVLANWKKKDPNGPMTYENMDILFSFPGGDCDKGFFLVSLLVEIAASP
AIKAIPTVSSAVERQDLKALEKALHDIATSLEKAKEIFKRMRDFVDPDTFFHVLRIYLSG
WKCSSKLPEGLLYEGVWDTPKMFSGGSAGQSSIFQSLDVLLGIKHEAGKESPAEFLQEMR
EYMPPAHRNFLFFLESAPPVREFVISRHNEDLTKAYNECVNGLVSVRKFHLAIVDTYIMK
PSKKKPTDGDKSEEPSNVESRGTGGTNPMTFLRSVKDTTEKALLSWP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31883
n/a
NameBDBM31883
Synonyms:9-cis-retinoic acid (9cRA) | ALL-TRANS-RETINOIC ACID | AT-RA | Atralin | CHEMBL38 | MLS000028588 | SMR000058245 | TRETINOIN | Vitamin A acid | [3H]RA | [3H]Retinoic acid | [3H]Vitamin A acid | [3H]tretinoin | all-trans retinoic acid | cid_444795
Typeradiolabeled ligand
Emp. Form.C20H28O2
Mol. Mass.300.4351
SMILESC\C(\C=C\C1=C(C)CCCC1(C)C)=C/C=C/C(/C)=C/C(O)=O |c:4|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: