Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTau
LigandBDBM50129793
Substrate/Competitorn/a
Meas. Tech.ChEMBL_886329
IC50 3255±n/a nM
Citation Gu JAnumala URLo Monte FKramer THeyny von Haußen RHölzer JGoetschy-Meyer VMall GHilger ICzech CSchmidt B 2-Styrylindolium based fluorescent probes visualize neurofibrillary tangles in Alzheimer's disease. Bioorg Med Chem Lett 22:7667-71 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tau
Name:Microtubule-associated protein tau
Synonyms:MAPT | MAPTL | MTBT1 | Microtubule-associated protein tau | Neurofibrillary tangle protein | PHF-tau | Paired helical filament-tau | Tau Protein
Type:Protein
Mol. Mass.:78928.63
Organism:Homo sapiens (Human)
Description:P10636
Residue:758
Sequence:
MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPG
SETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAG
HVTQEPESGKVVQEGFLREPGPPGLSHQLMSGMPGAPLLPEGPREATRQPSGTGPEDTEG
GRHAPELLKHQLLGDLHQEGPPLKGAGGKERPGSKEEVDEDRDVDESSPQDSPPSKASPA
QDGRPPQTAAREATSIPGFPAEGAIPLPVDFLSKVSTEIPASEPDGPSVGRAKGQDAPLE
FTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPA
AAPRGKPVSRVPQLKARMVSKSKDGTGSDDKKAKTSTRSSAKTLKNRPCLSPKHPTPGSS
DPLIQPSSPAVCPEPPSSPKYVSSVTSRTGSSGAKEMKLKGADGKTKIATPRGAAPPGQK
GQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREP
KKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLD
LSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEK
LDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDT
SPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50129793
n/a
NameBDBM50129793
Synonyms:2-(4''-methylaminophenyl)-6-hydroxybenzothiazole | 2-(4-(methylamino)phenyl)benzo[d]thiazol-6-ol | 2-(4-Methylamino-phenyl)-benzothiazol-6-ol | 4-methylamino-phenyl)-benzothiazol-6-ol | 6-Hydroxy-2-(4''-N-methylaminophenyl)-1,3-benzothiazole | CHEMBL1788111 | CHEMBL93124 | N-methyl-2-(4''-methylaminophenyl)-6-hydroxybenzothiazole | N-methyl-[11C]2-(40-methylaminophenyl)-6-hydroxy benzothiazole | [3H]2-(4-(methylamino)phenyl)benzo[d]thiazol-6-ol
TypeSmall organic molecule
Emp. Form.C14H12N2OS
Mol. Mass.256.323
SMILESCNc1ccc(cc1)-c1nc2ccc(O)cc2s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: