Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNPFF2
LigandBDBM50402444
Substrate/Competitorn/a
Meas. Tech.ChEMBL_886539
Ki 4±n/a nM
Citation Gealageas RSchneider SHumbert JPBertin ISchmitt MLaboureyras EDugave CMollereau CSimonnet GBourguignon JJSimonin FBihel F Development of sub-nanomolar dipeptidic ligands of neuropeptide FF receptors. Bioorg Med Chem Lett 22:7471-4 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
NPFF2
Name:NPFF2
Synonyms:G-protein coupled receptor 74 | G-protein coupled receptor HLWAR77 | Neuropeptide FF receptor 2 | Neuropeptide G-protein coupled receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:60293.78
Organism:Homo sapiens (Human)
Description:NPFF2 0 HUMAN::Q9Y5X5
Residue:522
Sequence:
MNSFFGTPAASWCLLESDVSSAPDKEAGRERRALSVQQRGGPAWSGSLEWSRQSAGDRRR
LGLSRQTAKSSWSRSRDRTCCCRRAWWILVPAADRARRERFIMNEKWDTNSSENWHPIWN
VNDTKHHLYSDINITYVNYYLHQPQVAAIFIISYFLIFFLCMMGNTVVCFIVMRNKHMHT
VTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAASVFTLVA
IAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQN
KTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAAVPHTGRKN
QEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYADLSPNELQIINIYIYPFA
HWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQKRAKPMEAYALKAKSHVLINTSNQ
LVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETTNSSEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50402444
n/a
NameBDBM50402444
Synonyms:CHEMBL2208319
TypeSmall organic molecule
Emp. Form.C29H34N6O3
Mol. Mass.514.6187
SMILES[#7]\[#6](-[#7])=[#7]\[#6]-[#6]-[#6]-[#6@@H](-[#7]-[#6](=O)-[#6](-c1ccccc1)-c1ccccc1)-[#6](=O)-[#7]-[#6@@H](-[#6]-c1ccccc1)-[#6](-[#7])=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: