Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuropeptide FF receptor 1
LigandBDBM50402453
Substrate/Competitorn/a
Meas. Tech.ChEMBL_886542
Ki 2±n/a nM
Citation Gealageas RSchneider SHumbert JPBertin ISchmitt MLaboureyras EDugave CMollereau CSimonnet GBourguignon JJSimonin FBihel F Development of sub-nanomolar dipeptidic ligands of neuropeptide FF receptors. Bioorg Med Chem Lett 22:7471-4 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neuropeptide FF receptor 1
Name:Neuropeptide FF receptor 1
Synonyms:G-protein coupled receptor 147 | RFamide-related peptide receptor OT7T022
Type:PROTEIN
Mol. Mass.:47840.07
Organism:Homo sapiens (Human)
Description:ChEMBL_1474637
Residue:430
Sequence:
MEGEPSQPPNSSWPLSQNGTNTEATPATNLTFSSYYQHTSPVAAMFIVAYALIFLLCMVG
NTLVCFIVLKNRHMHTVTNMFILNLAVSDLLVGIFCMPTTLVDNLITGWPFDNATCKMSG
LVQGMSVSASVFTLVAIAVERFRCIVHPFREKLTLRKALVTIAVIWALALLIMCPSAVTL
TVTREEHHFMVDARNRSYPLYSCWEAWPEKGMRRVYTTVLFSHIYLAPLALIVVMYARIA
RKLCQAPGPAPGGEEAADPRASRRRARVVHMLVMVALFFTLSWLPLWALLLLIDYGQLSA
PQLHLVTVYAFPFAHWLAFFNSSANPIIYGYFNENFRRGFQAAFRARLCPRPSGSHKEAY
SERPGGLLHRRVFVVVRPSDSGLPSESGPSSGAPRPGRLPLRNGRVAHHGLPREGPGCSH
LPLTIPAWDI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50402453
n/a
NameBDBM50402453
Synonyms:CHEMBL2208338
TypeSmall organic molecule
Emp. Form.C28H32N6O3
Mol. Mass.500.5921
SMILES[#7]\[#6](-[#7])=[#7]\[#6]-[#6]-[#6]-[#6@@H](-[#7]-[#6](=O)-c1ccccc1-c1ccccc1)-[#6](=O)-[#7]-[#6@@H](-[#6]-c1ccccc1)-[#6](-[#7])=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: