| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sphingosine 1-phosphate receptor 3 |
|---|
| Ligand | BDBM50402736 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_886917 (CHEMBL2211873) |
|---|
| EC50 | 485±n/a nM |
|---|
| Citation |  Aguilar, N; Mir, M; Grima, PM; López, M; Segarra, V; Esteban, L; Moreno, I; Godessart, N; Tarrasón, G; Domenech, T; Vilella, D; Armengol, C; Córdoba, M; Sabaté, M; Casals, D; Domínguez, M Discovery of a novel class of zwitterionic, potent, selective and orally active S1P1 direct agonists. Bioorg Med Chem Lett22:7672-6 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sphingosine 1-phosphate receptor 3 |
|---|
| Name: | Sphingosine 1-phosphate receptor 3 |
|---|
| Synonyms: | C9orf108 | C9orf47 | EDG3 | Endothelial differentiation G-protein coupled receptor 3 | S1P receptor 3 | S1P receptor Edg-3 | S1P3 | S1PR3 | S1PR3_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor 3 (S1P3) | Sphingosine 1-phosphate receptor Edg-3 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 42278.13 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99500 |
|---|
| Residue: | 378 |
|---|
| Sequence: | MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMV
LIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFV
ALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLH
NLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMA
LLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTL
ASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAP
SSCIMDKNAALQNGIFCN
|
|
|
|---|
| BDBM50402736 |
|---|
| n/a |
|---|
| Name | BDBM50402736 |
|---|
| Synonyms: | CHEMBL2207779 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H27FN4O3S |
|---|
| Mol. Mass. | 482.57 |
|---|
| SMILES | CCCCN(C(=O)c1ccccc1F)c1nnc(s1)-c1ccc(CN2CCC(C2)C(O)=O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
