Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetExtracellular signal-regulated kinase 5 (ERK5)
LigandBDBM50392982
Substrate/Competitorn/a
Meas. Tech.ChEMBL_884736
Kd>10000±n/a nM
Citation Gong LTan YCBoice GAbbot SMcCaleb KIyer PZuo FDal Porto JWong BJin SChang ATran PHsieh GNiu LShao AReuter DLukacs CMUrsula Kammlott RKuglstatter AGoldstein D Discovery of a novel series of 4-quinolone JNK inhibitors. Bioorg Med Chem Lett 22:7381-7 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Extracellular signal-regulated kinase 5 (ERK5)
Name:Extracellular signal-regulated kinase 5 (ERK5)
Synonyms:Big MAP kinase 1 | ERK5 | Mitogen-activated protein kinase 7
Type:Protein
Mol. Mass.:88377.36
Organism:Homo sapiens (Human)
Description:Q13164
Residue:816
Sequence:
MAEPLKEEDGEDGSAEPPGPVKAEPAHTAASVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMP
SPWAPSGDCAMESPPPAPPPCPGPAPDTIDLTLQPPPPVSEPAPPKKDGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGASGGPSTDPLAGLVLSDNDRSLLERWTRMARPAAPALTSVPAPAPAPTPTPTPV
QPTSPPPGPVAQPTGPQPQSAGSTSGPVPQPACPPPGPAPHPTGPPGPIPVPAPPQIATS
TSLLAAQSLVPPPGLPGSSTPGVLPYFPPGLPPPDAGGAPQSSMSESPDVNLVTQQLSKS
QVEDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLAD
WLEGHGMNPADIESLQREIQMDSPMLLADLPDLQDP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50392982
n/a
NameBDBM50392982
Synonyms:CHEMBL2152382
TypeSmall organic molecule
Emp. Form.C27H23ClN2O5
Mol. Mass.490.935
SMILESCOC(=O)c1c(Cc2ccc(cc2)C(=O)NCCO)c(=O)c2ccc(Cl)cc2n1-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: