| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cannabinoid receptor 2 |
|---|
| Ligand | BDBM50402860 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_885145 (CHEMBL2213236) |
|---|
| Ki | 3110±n/a nM |
|---|
| Citation |  Thur, Y; Bhalerao, A; Munshi, Z; Pansare, N; Mann, K; Hanauer, G; Kley, HP; Nappe, S; Weiss-Haljiti, C; Ostermann, C; Zitt, C; Schaefer, M; Mondal, D; Ali Siddiki, A; Armugam, V; Gudaghe, V; Gupta, M; Rayudu, P; Dautzenberg, FM; Das Sarma, K Structure-activity relationships of 2-arylamido-5,7-dihydro-4H-thieno[2,3-c]pyran-3-carboxamide derivatives as cannabinoid receptor agonists and their analgesic action. Bioorg Med Chem Lett22:7314-21 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cannabinoid receptor 2 |
|---|
| Name: | Cannabinoid receptor 2 |
|---|
| Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CNR2_RAT | Cannabinoid CB2 receptor | Cannabinoid receptor | Cnr2 | rCB2 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39366.68 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | Q9QZN9 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MAGCRELELTNGSNGGLEFNPMKEYMILSDAQQIAVAVLCTLMGLLSALENVAVLYLILS
SQRLRRKPSYLFIGSLAGADFLASVIFACNFVIFHVFHGVDSRNIFLLKIGSVTMTFTAS
VGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALGVMWVLSALISYLPLMGWTCCPSPCS
ELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHQHVASLAEHQDRQVPGIARMRLD
VRLAKTLGLVMAVLLICWFPALALMGHSLVTTLSDKVKEAFAFCSMLCLVNSMINPIIYA
LRSGEIRSAAQHCLTGWKKYLQGLGSEGKEEAPKSSVTETEAEVKTTTGPGSRTPGCSNC
|
|
|
|---|
| BDBM50402860 |
|---|
| n/a |
|---|
| Name | BDBM50402860 |
|---|
| Synonyms: | CHEMBL2205588 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H19F3N2O4S |
|---|
| Mol. Mass. | 440.436 |
|---|
| SMILES | COC1CN(C1)C(=O)c1c(NC(=O)c2ccccc2C(F)(F)F)sc2COCCc12 |
|---|
| Structure | 
|
|---|
Search and Browse
