Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein-tyrosine kinase 2-beta
LigandBDBM50402998
Substrate/Competitorn/a
Meas. Tech.ChEMBL_885497
IC50 524±n/a nM
Citation Bhattacharya SKAspnes GEBagley SWBoehm MBrosius ADBuckbinder LChang JSDibrino JEng HFrederick KSGriffith DAGriffor MCGuimarães CRGuzman-Perez AHan SKalgutkar ASKlug-McLeod JGarcia-Irizarry CLi JLippa BPrice DASouthers JAWalker DPWei LXiao JZawistoski MPZhao X Identification of novel series of pyrazole and indole-urea based DFG-out PYK2 inhibitors. Bioorg Med Chem Lett 22:7523-9 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein-tyrosine kinase 2-beta
Name:Protein-tyrosine kinase 2-beta
Synonyms:CADTK | CAK-beta | CAKB | Calcium-dependent tyrosine kinase | Calcium-regulated non-receptor proline-rich tyrosine kinase | Cell adhesion kinase beta | FADK 2 | Fak2 | Focal adhesion kinase 2 | Focaladhesion kinase 2 | Proline-rich tyrosine kinase 2 | Ptk2b | Pyk2 | RAFTK | Related adhesion focal tyrosine kinase
Type:PROTEIN
Mol. Mass.:115790.07
Organism:Mus musculus
Description:ChEMBL_885497
Residue:1009
Sequence:
MSGVSEPLSRVKVGTLRRPEGPPEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEIQEIITSILLSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDTKPTCLA
EFKQIKSIRCLPLEETQAVLQLGIEGAPQSLSIKTSSLAEAENMADLIDGYCRLQGEHKG
SLIMHAKKDGEKRNSLPQIPTLNLEARRSHLSESCSIESDIYAEIPDETLRRPGGPQYGV
AREEVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTQDNKEKFMSEAVIMKN
LDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVPTLVLYTLQICKAMAYL
ESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPELCPPVLYTLMTR
CWDYDPSDRPRFTELVCSLSDIYQMEKDIAIEQERNARYRPPKILEPTTFQEPPPKPSRP
KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFIRPSSREEAQQLWEAEKIKMKQVLERQQKQMVEDSQWLRREERCLDPMVYMNDKSP
LTPEKEAGYTEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYHNVMTLVEAVLELKNKLGQ
LPPEDYVVVVKNVGLNLRKLIGSVDDLLPSLPASSRTEIEGTQKLLNKDLAELINKMKLA
QQNAVTSLSEDCKRQMLTASHTLAVDAKNLLDAVDQAKVVANLAHPPAE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50402998
n/a
NameBDBM50402998
Synonyms:CHEMBL2207433
TypeSmall organic molecule
Emp. Form.C24H27N7O2
Mol. Mass.445.5169
SMILESCOc1ccc(cn1)-c1cc(NC(=O)Nc2cc(nn2-c2ccc(C)cc2)C(C)(C)C)[nH]n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: