Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPTK2B protein tyrosine kinase 2 beta (PTK2B)
LigandBDBM50402991
Substrate/Competitorn/a
Meas. Tech.ChEMBL_885500
IC50 57±n/a nM
Citation Bhattacharya SKAspnes GEBagley SWBoehm MBrosius ADBuckbinder LChang JSDibrino JEng HFrederick KSGriffith DAGriffor MCGuimarães CRGuzman-Perez AHan SKalgutkar ASKlug-McLeod JGarcia-Irizarry CLi JLippa BPrice DASouthers JAWalker DPWei LXiao JZawistoski MPZhao X Identification of novel series of pyrazole and indole-urea based DFG-out PYK2 inhibitors. Bioorg Med Chem Lett 22:7523-9 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
PTK2B protein tyrosine kinase 2 beta (PTK2B)
Name:PTK2B protein tyrosine kinase 2 beta (PTK2B)
Synonyms:PTK2B | PTK2B protein tyrosine kinase 2 beta | Protein tyrosine kinase 2 beta
Type:Protein
Mol. Mass.:115868.80
Organism:Homo sapiens (Human)
Description:Q14289
Residue:1009
Sequence:
MSGVSEPLSRVKLGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEIREIITSILLSGRIGPNIRLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
EFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDGYCRLQGEHQG
SLIIHPRKDGEKRNSLPQIPMLNLEARRSHLSESCSIESDIYAEIPDETLRRPGGPQYGI
AREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKN
LDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYL
ESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTR
CWDYDPSDRPRFTELVCSLSDVYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRP
KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSP
LTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQ
LPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLA
QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50402991
n/a
NameBDBM50402991
Synonyms:CHEMBL2207428
TypeSmall organic molecule
Emp. Form.C31H37N7O2
Mol. Mass.539.6712
SMILESCc1ccc(cc1)-n1nc(cc1NC(=O)Nc1cccc2cc([nH]c12)C(=O)N1CCC2(CCNC2)C1)C(C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: