Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarnitine palmitoyltransferase 1B
LigandBDBM50122839
Substrate/Competitorn/a
Meas. Tech.ChEMBL_887418
IC50 1450±n/a nM
Citation Ceccarelli SMChomienne OGubler MArduini A Carnitine palmitoyltransferase (CPT) modulators: a medicinal chemistry perspective on 35 years of research. J Med Chem 54:3109-52 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carnitine palmitoyltransferase 1B
Name:Carnitine palmitoyltransferase 1B
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:88241.28
Organism:Rattus norvegicus
Description:ChEMBL_887447
Residue:772
Sequence:
MAEAHQAVAFQFTVTPDGVDFRLSREALRHIYLSGINSWKKRLIRIKNGILRGVYPGSPT
SWLVVVMATVGSNYCKVDISMGLVHCIQRCLPTRYGSYGTPQTETLLSMVIFSTGVWATG
IFLFRQTLKLLLSYHGWMFEMHSKTSHATKIWAICVRLLSSRRPMLYSFQTSLPKLPVPS
VPATIHRYLDSVRPLLDDEAYFRMESLAKEFQDKIAPRLQKYLVLKSWWATNYVSDWWEE
YVYLRGRSPIMVNSNYYAMDFVLIKNTSQQAARLGNTVHAMIMYRRKLDREEIKPVMALG
MVPMCSYQMERMFNTTRIPGKETDLLQHLSESRHVAVYHKGRFFKVWLYEGSCLLKPRDL
EMQFQRILDDTSPPQPGEEKLAALTAGGRVEWAEARQKFFSSGKNKMSLDTIERAAFFVA
LDEDSHCYNPDDEASLSLYGKSLLHGNCYNRWFDKSFTLISCKNGQLGLNTEHSWADAPI
IGHLWEFVLATDTFHLGYTETGHCVGEPNTKLPPPQRMQWDIPEQCQTAIENSYQVAKAL
ADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDKGKFCLTYEASMTRMFREG
RTETVRSCTSESTAFVRAMMTGSHKKQDLQDLFRKASEKHQNMYRLAMTGAGIDRHLFCL
YIVSKYLGVRSPFLDEVLSEPWSLSTSQIPQFQICMFDPKQYPNHLGAGGGFGPVADHGY
GVSYMIAGENTMFFHVSSKLSSSETNALRFGNHIRQALLDIADLFKISKTDS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50122839
n/a
NameBDBM50122839
Synonyms:CHEMBL106227 | [3-Carboxy-2-(3-tetradecyl-ureido)-propyl]-trimethyl-ammonium
TypeSmall organic molecule
Emp. Form.C22H45N3O3
Mol. Mass.399.611
SMILESCCCCCCCCCCCCCCNC(=O)N[C@H](CC([O-])=O)C[N+](C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: