Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarnitine palmitoyltransferase 2
LigandBDBM50403034
Substrate/Competitorn/a
Meas. Tech.ChEMBL_887441
IC50 5100±n/a nM
Citation Ceccarelli SMChomienne OGubler MArduini A Carnitine palmitoyltransferase (CPT) modulators: a medicinal chemistry perspective on 35 years of research. J Med Chem 54:3109-52 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carnitine palmitoyltransferase 2
Name:Carnitine palmitoyltransferase 2
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:74118.53
Organism:Rattus norvegicus
Description:ChEMBL_887443
Residue:658
Sequence:
MMPRLLFRAWPRCPSLVLGAPSRPLSAVSGPDDYLQHSIVPTMHYQDSLPRLPIPKLEDT
MKRYLNAQKPLLDDSQFRRTEALCKNFETGVGKELHAHLLAQDKQNKHTSYISGPWFDMY
LTARDSIVLNFNPFMAFNPDPKSEYNDQLTRATNLTVSAVRFLKTLQAGLLEPEVFHLNP
SKSDTDAFKRLIRFVPPSLSWYGAYLVNAYPLDMSQYFRLFNSTRIPRPNRDELFTDTKA
RHLLVLRKGHFYVFDVLDQDGNIVNPLEIQAHLKYILSDSSPVPEFPVAYLTSENRDVWA
ELRQKLIFDGNEETLKKVDSAVFCLCLDDFPMKDLIHLSHTMLHGDGTNRWFDKSFNLIV
AEDGTAAVHFEHSWGDGVAVLRFFNEVFRDSTQTPAITPQSQPAATNSSASVETLSFNLS
GALKAGITAAKEKFDTTVKTLSIDSIQFQRGGKEFLKKKQLSPDAVAQLAFQMAFLRQYG
QTVATYESCSTAAFKHGRTETIRPASIFTKRCSEAFVRDPSKHSVGELQHMMAECSKYHG
QLTKEAAMGQGFDRHLYALRYLATARGLNLPELYLDPAYQQMNHNILSTSTLNSPAVSLG
GFAPVVPDGFGIAYAVHDDWIGCNVSSYSGRNAREFLHCVQKCLEDIFDALEGKAIKT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50403034
n/a
NameBDBM50403034
Synonyms:CHEMBL2114397
TypeSmall organic molecule
Emp. Form.C7H16N2O2
Mol. Mass.160.2141
SMILESC[N+](C)(C)C[C@H](N)CC([O-])=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: