Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarnitine O-palmitoyltransferase 1, muscle isoform
LigandBDBM50403039
Substrate/Competitorn/a
Meas. Tech.ChEMBL_887462
IC50 3400±n/a nM
Citation Ceccarelli SMChomienne OGubler MArduini A Carnitine palmitoyltransferase (CPT) modulators: a medicinal chemistry perspective on 35 years of research. J Med Chem 54:3109-52 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carnitine O-palmitoyltransferase 1, muscle isoform
Name:Carnitine O-palmitoyltransferase 1, muscle isoform
Synonyms:CPT I | CPT1-M | CPT1B | CPTI-M | Carnitine O-palmitoyltransferase I, muscle isoform | Carnitine palmitoyltransferase I-like protein | KIAA1670
Type:PROTEIN
Mol. Mass.:87823.36
Organism:Homo sapiens (Human)
Description:ChEMBL_887440
Residue:772
Sequence:
MAEAHQAVAFQFTVTPDGVDFRLSREALKHVYLSGINSWKKRLIRIKNGILRGVYPGSPT
SWLVVIMATVGSSFCNVDISLGLVSCIQRCLPQGCGPYQTPQTRALLSMAIFSTGVWVTG
IFFFRQTLKLLLCYHGWMFEMHGKTSNLTRIWAMCIRLLSSRHPMLYSFQTSLPKLPVPR
VSATIQRYLESVRPLLDDEEYYRMELLAKEFQDKTAPRLQKYLVLKSWWASNYVSDWWEE
YIYLRGRSPLMVNSNYYVMDLVLIKNTDVQAARLGNIIHAMIMYRRKLDREEIKPVMALG
IVPMCSYQMERMFNTTRIPGKDTDVLQHLSDSRHVAVYHKGRFFKLWLYEGARLLKPQDL
EMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAALEAIERAAFFVA
LDEESYSYDPEDEASLSLYGKALLHGNCYNRWFDKSFTLISFKNGQLGLNAEHAWADAPI
IGHLWEFVLGTDSFHLGYTETGHCLGKPNPALAPPTRLQWDIPKQCQAVIESSYQVAKAL
ADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDRGKFCLTYEASMTRMFREG
RTETVRSCTSESTAFVQAMMEGSHTKADLRDLFQKAAKKHQNMYRLAMTGAGIDRHLFCL
YLVSKYLGVSSPFLAEVLSEPWRLSTSQIPQSQIRMFDPEQHPNHLGAGGGFGPVADDGY
GVSYMIAGENTIFFHISSKFSSSETNAQRFGNHIRKALLDIADLFQVPKAYS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50403039
n/a
NameBDBM50403039
Synonyms:CHEMBL2216778
TypeSmall organic molecule
Emp. Form.C23H18ClFN2O7S
Mol. Mass.520.915
SMILESCOc1ccc(Cl)cc1S(=O)(=O)N1CC(Oc2ccc(cc12)C(=O)Nc1cccc(F)c1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: