Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarnitine palmitoyltransferase 2
LigandBDBM50046145
Substrate/Competitorn/a
Meas. Tech.ChEMBL_887451
Ki 4200±n/a nM
Citation Ceccarelli SMChomienne OGubler MArduini A Carnitine palmitoyltransferase (CPT) modulators: a medicinal chemistry perspective on 35 years of research. J Med Chem 54:3109-52 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carnitine palmitoyltransferase 2
Name:Carnitine palmitoyltransferase 2
Synonyms:CPT II | Carnitine O-palmitoyltransferase 2, mitochondrial | Carnitine palmitoyltransferase II
Type:PROTEIN
Mol. Mass.:73789.25
Organism:Homo sapiens (Human)
Description:ChEMBL_887455
Residue:658
Sequence:
MVPRLLLRAWPRGPAVGPGAPSRPLSAGSGPGQYLQRSIVPTMHYQDSLPRLPIPKLEDT
IRRYLSAQKPLLNDGQFRKTEQFCKSFENGIGKELHEQLVALDKQNKHTSYISGPWFDMY
LSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRAGLLEPEVFHLNP
AKSDTITFKRLIRFVPSSLSWYGAYLVNAYPLDMSQYFRLFNSTRLPKPSRDELFTDDKA
RHLLVLRKGNFYIFDVLDQDGNIVSPSEIQAHLKYILSDSSPAPEFPLAYLTSENRDIWA
ELRQKLMSSGNEESLRKVDSAVFCLCLDDFPIKDLVHLSHNMLHGDGTNRWFDKSFNLII
AKDGSTAVHFEHSWGDGVAVLRFFNEVFKDSTQTPAVTPQSQPATTDSTVTVQKLNFELT
DALKTGITAAKEKFDATMKTLTIDCVQFQRGGKEFLKKQKLSPDAVAQLAFQMAFLRQYG
QTVATYESCSTAAFKHGRTETIRPASVYTKRCSEAFVREPSRHSAGELQQMMVECSKYHG
QLTKEAAMGQGFDRHLFALRHLAAAKGIILPELYLDPAYGQINHNVLSTSTLSSPAVNLG
GFAPVVSDGFGVGYAVHDNWIGCNVSSYPGRNAREFLQCVEKALEDMFDALEGKSIKS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50046145
n/a
NameBDBM50046145
Synonyms:2-[6-hydroxy-4,4-dimethyl-6-pentadecyl-(2R,6S)-1,4-oxazinan-4-ium-2-yl]acetate(hemipalmitoylcarnitinium (HPC)) | Acylcarnitine analogue | CHEMBL48257 | Hemiacylcarnitinium(+)-HPC
TypeSmall organic molecule
Emp. Form.C23H45NO4
Mol. Mass.399.6077
SMILESCCCCCCCCCCCCCCC[C@@]1(O)C[N+](C)(C)C[C@@H](CC([O-])=O)O1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: