Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarnitine palmitoyltransferase 1B
LigandBDBM80613
Substrate/Competitorn/a
Meas. Tech.ChEMBL_887447
IC50 1300±n/a nM
Citation Ceccarelli SMChomienne OGubler MArduini A Carnitine palmitoyltransferase (CPT) modulators: a medicinal chemistry perspective on 35 years of research. J Med Chem 54:3109-52 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carnitine palmitoyltransferase 1B
Name:Carnitine palmitoyltransferase 1B
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:88241.28
Organism:Rattus norvegicus
Description:ChEMBL_887447
Residue:772
Sequence:
MAEAHQAVAFQFTVTPDGVDFRLSREALRHIYLSGINSWKKRLIRIKNGILRGVYPGSPT
SWLVVVMATVGSNYCKVDISMGLVHCIQRCLPTRYGSYGTPQTETLLSMVIFSTGVWATG
IFLFRQTLKLLLSYHGWMFEMHSKTSHATKIWAICVRLLSSRRPMLYSFQTSLPKLPVPS
VPATIHRYLDSVRPLLDDEAYFRMESLAKEFQDKIAPRLQKYLVLKSWWATNYVSDWWEE
YVYLRGRSPIMVNSNYYAMDFVLIKNTSQQAARLGNTVHAMIMYRRKLDREEIKPVMALG
MVPMCSYQMERMFNTTRIPGKETDLLQHLSESRHVAVYHKGRFFKVWLYEGSCLLKPRDL
EMQFQRILDDTSPPQPGEEKLAALTAGGRVEWAEARQKFFSSGKNKMSLDTIERAAFFVA
LDEDSHCYNPDDEASLSLYGKSLLHGNCYNRWFDKSFTLISCKNGQLGLNTEHSWADAPI
IGHLWEFVLATDTFHLGYTETGHCVGEPNTKLPPPQRMQWDIPEQCQTAIENSYQVAKAL
ADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDKGKFCLTYEASMTRMFREG
RTETVRSCTSESTAFVRAMMTGSHKKQDLQDLFRKASEKHQNMYRLAMTGAGIDRHLFCL
YIVSKYLGVRSPFLDEVLSEPWSLSTSQIPQFQICMFDPKQYPNHLGAGGGFGPVADHGY
GVSYMIAGENTMFFHVSSKLSSSETNALRFGNHIRQALLDIADLFKISKTDS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM80613
n/a
NameBDBM80613
Synonyms:1-(2,3,4-Trimethoxy-benzyl)-piperazine | 1-(2,3,4-trimethoxybenzyl)piperazine;hydrochloride | 1-[(2,3,4-trimethoxyphenyl)methyl]piperazine;hydrochloride | MLS001240268 | SMR000674573 | TRIMETAZIDINE | cid_9926449
TypeSmall organic molecule
Emp. Form.C14H22N2O3
Mol. Mass.266.3361
SMILESCOc1ccc(CN2CCNCC2)c(OC)c1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: