Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRibosyldihydronicotinamide dehydrogenase [quinone]
LigandBDBM50403047
Substrate/Competitorn/a
Meas. Tech.ChEMBL_887589
Ki 900±n/a nM
Citation Michaelis SMarais ASchrey AKGraebner OYSchaudt CSefkow MKroll FDreger MGlinski MKoester HMetternich RFischer JJ Dabigatran and dabigatran ethyl ester: potent inhibitors of ribosyldihydronicotinamide dehydrogenase (NQO2). J Med Chem 55:3934-44 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ribosyldihydronicotinamide dehydrogenase [quinone]
Name:Ribosyldihydronicotinamide dehydrogenase [quinone]
Synonyms:Metallothionein-3 | NRH dehydrogenase [quinone] 2 | NRH:quinone oxidoreductase 2 | QR2 | Quinone reductase 2 | Quinone reductase 2 (NQO2) | Ribosyldihydronicotinamide dehydrogenase [quinone]
Type:Protein
Mol. Mass.:25917.25
Organism:Homo sapiens (Human)
Description:P16083
Residue:231
Sequence:
MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATDKDITGTL
SNPEVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRV
LCQGFAFDIPGFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFC
GFKVLAPQISFAPEIASEEERKGMVAAWSQRLQTIWKEEPIPCTAHWHFGQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50403047
n/a
NameBDBM50403047
Synonyms:CHEMBL1231568
TypeSmall organic molecule
Emp. Form.C27H29N7O3
Mol. Mass.499.5643
SMILESCCOC(=O)CCN(C(=O)c1ccc2n(C)c(CNc3ccc(cc3)C(N)=N)nc2c1)c1ccccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: