Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProto-oncogene tyrosine-protein kinase Src
LigandBDBM4567
Substrate/Competitorn/a
Meas. Tech.ChEMBL_887649
IC50>27000±n/a nM
Citation Barf TKaptein A Irreversible protein kinase inhibitors: balancing the benefits and risks. J Med Chem 55:6243-62 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Proto-oncogene tyrosine-protein kinase Src
Name:Proto-oncogene tyrosine-protein kinase Src
Synonyms:Proto-oncogene c-Src | Tyrosine-protein kinase SRC | c-Src | p60-Src | p60c-src | pp60c-src
Type:Tyr protein kinase
Mol. Mass.:60015.36
Organism:Gallus gallus (Chicken)
Description:P00523
Residue:533
Sequence:
MGSSKSKPKDPSQRRRSLEPPDSTHHGGFPASQTPNKTAAPDTHRTPSRSFGTVATEPKL
FGGFNTSDTVTSPQRAGALAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWL
AHSLTTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNPENPRGTFLVRESETT
KGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHR
LTNVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPG
TMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGEMGKYLRL
PQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQ
GAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYR
MPCPPECPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM4567
n/a
NameBDBM4567
Synonyms:4-anilinoquinazoline deriv. 2 | BMC163482 Compound 1 | CHEMBL285063 | N-{4-[(3-bromophenyl)amino]quinazolin-6-yl}prop-2-enamide | US9422297, PD168393
TypeSmall organic molecule
Emp. Form.C17H13BrN4O
Mol. Mass.369.215
SMILESBrc1cccc(Nc2ncnc3ccc(NC(=O)C=C)cc23)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: