Reaction Details |
| Report a problem with these data |
Target | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
---|
Ligand | BDBM50368782 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_205190 (CHEMBL812006) |
---|
Ki | 4.0±n/a nM |
---|
Citation | Abell, AD; Erhard, KF; Yen, H; Yamashita, DS; Brandt, M; Mohammed, H; Levy, MA; Holt, DA Preparative chiral HPLC separation of all possible stereoisomers of LY191704 and LY266111 and their in vitro inhibition of human types 1 and 2 steroid 5-reductases Bioorg Med Chem Lett4:1365-1368 (1994) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
---|
Name: | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
Synonyms: | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 | 5α-Reductase 1 (5α-R1) | S5A1_HUMAN | S5AR | SR type 1 | SRD5A1 | Steroid 5-alpha-reductase | Steroid 5-alpha-reductase 1 |
Type: | Enzyme |
Mol. Mass.: | 29472.80 |
Organism: | Homo sapiens (Human) |
Description: | P18405 |
Residue: | 259 |
Sequence: | MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQE
LPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMA
IMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGD
TGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWY
LRKFEEYPKFRKIIIPFLF
|
|
|
BDBM50368782 |
---|
n/a |
---|
Name | BDBM50368782 |
Synonyms: | Bexlosteride | CHEMBL24955 | LY-191704 |
Type | Small organic molecule |
Emp. Form. | C14H16ClNO |
Mol. Mass. | 249.736 |
SMILES | CN1[C@@H]2CCc3cc(Cl)ccc3[C@H]2CCC1=O |
Structure |
|