Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Ligand | BDBM50403335 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_66423 |
---|
Ki | 25±n/a nM |
---|
Citation | Yamashita, DS; Oh, H; Yen, H; Bossard, MJ; Brandt, M; Levy, MA; Newman-Tarr, T; Badger, A; Luengo, JI; Holt, DA Design, synthesis and evaluation of dual domain FKBP ligands Bioorg Med Chem Lett4:325-328 (1994) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
Synonyms: | 12 kDa FK506-binding protein | 12 kDa FKBP | FK506-binding protein 1A | FK506-binding protein 1A (FKBP12) | FKB1A_HUMAN | FKBP-12 | FKBP-1A | FKBP1 | FKBP12 | FKBP1A | Immunophilin FKBP12 | PPIase | PPIase FKBP1A | Peptidyl-prolyl cis-trans isomerase (FKBP) | Rotamase | RyR1/FKBP12 | mTOR/FKBP12A/FKBP12B |
Type: | Isomerase |
Mol. Mass.: | 11953.09 |
Organism: | Homo sapiens (Human) |
Description: | P62942 |
Residue: | 108 |
Sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
|
|
|
BDBM50403335 |
---|
n/a |
---|
Name | BDBM50403335 |
Synonyms: | CHEMBL325145 |
Type | Small organic molecule |
Emp. Form. | C32H45NO7 |
Mol. Mass. | 555.7022 |
SMILES | CC1(C)CCC(=O)CCCCC(=O)OCC(C)(C)C(=O)C(=O)N2CCCC[C@H]2C(=O)O[C@@H]1CCc1ccccc1 |
Structure |
|