Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50403348 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_157883 |
---|
Ki | 7.9±n/a nM |
---|
Citation | Thompson, SK; Eppley, AM; Frazee, JS; Darcy, MG; Lum, RT; Tomaszek, TA; Ivanoff, LA; Morris, JF; Sternberg, EJ; Lambert, DM; Fernandez, AV; Petteway, SR; Meek, TD; Metcalf, BW; Gleason, JG Synthesis and antiviral activity of a novel class of HIV-1 protease inhibitors containing a heterocyclic P1-P2 amide bond isostere Bioorg Med Chem Lett4:2441-2446 (1994) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50403348 |
---|
n/a |
---|
Name | BDBM50403348 |
Synonyms: | CHEMBL421709 |
Type | Small organic molecule |
Emp. Form. | C33H46N4O4 |
Mol. Mass. | 562.7427 |
SMILES | CC(C)OC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](Cc1ccccc1)[C@@H](O)C[C@@H](Cc1ccccc1)c1ncc([nH]1)C(C)C |
Structure |
|