| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50403360 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_157883 |
|---|
| Ki | 1.4±n/a nM |
|---|
| Citation |  Thompson, SK; Eppley, AM; Frazee, JS; Darcy, MG; Lum, RT; Tomaszek, TA; Ivanoff, LA; Morris, JF; Sternberg, EJ; Lambert, DM; Fernandez, AV; Petteway, SR; Meek, TD; Metcalf, BW; Gleason, JG Synthesis and antiviral activity of a novel class of HIV-1 protease inhibitors containing a heterocyclic P1-P2 amide bond isostere Bioorg Med Chem Lett4:2441-2446 (1994) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50403360 |
|---|
| n/a |
|---|
| Name | BDBM50403360 |
|---|
| Synonyms: | CHEMBL1790592 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C36H44N4O5 |
|---|
| Mol. Mass. | 612.7584 |
|---|
| SMILES | CC(C)c1cnc([nH]1)[C@@H](C[C@H](O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)OCc1ccccc1)[C@H](C)O)Cc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
