new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H3 receptor
LigandBDBM22915
Substrate/Competitorn/a
Meas. Tech.ChEBML_83828
Ki 20±n/a nM
Citation Huls APurand KStark HLigneau XArrang JSchwartz JSchunack W Diphenylmethyl ethers: synthesis and histamine H3-receptor antagonist in vitro and in vivo activity Bioorg Med Chem Lett 6:2013-2018 (1996)    Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H3 receptor
Name:Histamine H3 receptor
Synonyms:HH3R
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:48607.98
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:445
Sequence:
MERAPPDGLMNASGTLAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCAS
SVFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMALVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGGREAG
PEPPPDAQPSPPPAPPSCWGCWPKGHGEAMPLHRYGVGEAGPGVEAGEAALGGGSGGGAA
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSITQRFRLSRDKKVAKSL
AIIVSIFGLCWAPYTLLMIIRAACHGRCIPDYWYETSFWLLWANSAVNPVLYPLCHYSFR
RAFTKLLCPQKLKVQPHGSLEQCWK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22915
n/a
NameBDBM22915
Synonyms:3-(1H-imidazol-4-yl)propylphenylmethyl ether | 5-[3-(benzyloxy)propyl]-1H-imidazole | CHEMBL61618 | PROXYFAN | Proxyfan
TypeSmall organic molecule
Emp. Form.C13H16N2O
Mol. Mass.216.2789
SMILESC(COCc1ccccc1)Cc1cnc[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: