Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50060073 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_145456 (CHEMBL751089) |
---|
EC50 | <10000±n/a nM |
---|
Citation | Santagada, V; Balboni, G; Caliendo, G; Guerrini, R; Salvadori, S; Bianchi, C; Bryant, SD; Lazarus, LH Assessment of substitution in the second pharmacophore of Dmt-Tic analogues. Bioorg Med Chem Lett10:2745-8 (2000) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50060073 |
---|
n/a |
---|
Name | BDBM50060073 |
Synonyms: | 2-[(S)-2-Amino-3-(4-hydroxy-2,6-dimethyl-phenyl)-propionyl]-1,2,3,4-tetrahydro-isoquinoline-3-carboxylic acid amide | 2-[2-Amino-3-(4-hydroxy-2,6-dimethyl-phenyl)-propionyl]-1,2,3,4-tetrahydro-isoquinoline-3-carboxylic acid amide | 2-[2-amino-3-(4-hydroxy-2,6-dimethylphenyl)-(2S)-propanoyl]-1,2,3,4-tetrahydro-3-isoquinolinecarboxamide | CHEMBL93041 |
Type | Small organic molecule |
Emp. Form. | C21H25N3O3 |
Mol. Mass. | 367.4415 |
SMILES | Cc1cc(O)cc(C)c1C[C@H](N)C(=O)N1Cc2ccccc2CC1C(N)=O |
Structure |
|