| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50060073 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_145305 (CHEMBL752840) |
|---|
| Ki | 277±n/a nM |
|---|
| Citation |  Santagada, V; Balboni, G; Caliendo, G; Guerrini, R; Salvadori, S; Bianchi, C; Bryant, SD; Lazarus, LH Assessment of substitution in the second pharmacophore of Dmt-Tic analogues. Bioorg Med Chem Lett10:2745-8 (2000) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50060073 |
|---|
| n/a |
|---|
| Name | BDBM50060073 |
|---|
| Synonyms: | 2-[(S)-2-Amino-3-(4-hydroxy-2,6-dimethyl-phenyl)-propionyl]-1,2,3,4-tetrahydro-isoquinoline-3-carboxylic acid amide | 2-[2-Amino-3-(4-hydroxy-2,6-dimethyl-phenyl)-propionyl]-1,2,3,4-tetrahydro-isoquinoline-3-carboxylic acid amide | 2-[2-amino-3-(4-hydroxy-2,6-dimethylphenyl)-(2S)-propanoyl]-1,2,3,4-tetrahydro-3-isoquinolinecarboxamide | CHEMBL93041 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H25N3O3 |
|---|
| Mol. Mass. | 367.4415 |
|---|
| SMILES | Cc1cc(O)cc(C)c1C[C@H](N)C(=O)N1Cc2ccccc2CC1C(N)=O |
|---|
| Structure | 
|
|---|
Search and Browse
