Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMalate dehydrogenase cytoplasmic
LigandBDBM50404702
Substrate/Competitorn/a
Meas. Tech.ChEMBL_52262
IC50 81283.05±n/a nM
Citation Coats EAShah KJMilstein SRGenther CSNene DMRoesener JSchmidt JPleiss MWagner EBaker JK 4-hydroxyquinoline-3-carboxylic acids as inhibitors of cell respiration. 2. Quantitative structure-activity relationship of dehydrogenase enzyme and Ehrlich ascites tumor cell inhibitions. J Med Chem 25:57-63 (1982) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Malate dehydrogenase cytoplasmic
Name:Malate dehydrogenase cytoplasmic
Synonyms:Cytosolic malate dehydrogenase | MDH1 | Malate Dehydrogenase, cytoplasmic
Type:Oxidoreductase; homodimer
Mol. Mass.:36453.77
Organism:Sus scrofa (pig)
Description:Porcine heart cytoplasmic fraction.
Residue:334
Sequence:
MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDC
ALPLLKDVIATDKEEIAFKDLDVAILVGSMPRRDGMERKDLLKANVKIFKCQGAALDKYA
KKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTSDDVKN
VIIWGNHSSTQYPDVNHAKVKLQAKEVGVYEAVKDDSWLKGEFITTVQQRGAAVIKARKL
SSAMSAAKAICDHVRDIWFGTPEGEFVSMGIISDGNSYGVPDDLLYSFPVTIKDKTWKIV
EGLPINDFSREKMDLTAKELAEEKETAFEFLSSA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50404702
n/a
NameBDBM50404702
Synonyms:CHEMBL160429
TypeSmall organic molecule
Emp. Form.C24H19NO6
Mol. Mass.417.4108
SMILESOC(=O)c1cnc2cc(OCCOc3ccc(Oc4ccccc4)cc3)ccc2c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: