Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMalate Dehydrogenase, mitochondrial
LigandBDBM50404724
Substrate/Competitorn/a
Meas. Tech.ChEMBL_123822
IC50 4786.3±n/a nM
Citation Coats EAShah KJMilstein SRGenther CSNene DMRoesener JSchmidt JPleiss MWagner EBaker JK 4-hydroxyquinoline-3-carboxylic acids as inhibitors of cell respiration. 2. Quantitative structure-activity relationship of dehydrogenase enzyme and Ehrlich ascites tumor cell inhibitions. J Med Chem 25:57-63 (1982) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Malate Dehydrogenase, mitochondrial
Name:Malate Dehydrogenase, mitochondrial
Synonyms:MDH2 | Malate dehydrogenase mitochondrial
Type:Oxidoreductase; homodimer
Mol. Mass.:35493.48
Organism:Sus scrofa (pig)
Description:Porcine heart mitochondria.
Residue:337
Sequence:
MLSALARPAGAALRRSFSTSQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHT
PGVAADLSHIETRATVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIV
ATLTAACAQHCPDAMICIISNPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANAFV
AELKGLDPARVSVPVIGGHAGKTIIPLISQCTPKVDFPQDQLSTLTGRIQEAGTEVVKAK
AGAGSATLSMAYAGARFVFSLVDAMNGKEGVVECSFVKSQETDCPYFSTPLLLGKKGIEK
NLGIGKISPFEEKMIAEAIPELKASIKKGEEFVKNMK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50404724
n/a
NameBDBM50404724
Synonyms:CHEMBL156108
TypeSmall organic molecule
Emp. Form.C17H8Cl5NO4
Mol. Mass.467.515
SMILESOC(=O)c1cnc2cc(OCc3c(Cl)c(Cl)c(Cl)c(Cl)c3Cl)ccc2c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: