Reaction Details |
| Report a problem with these data |
Target | Histamine H2 receptor |
---|
Ligand | BDBM22893 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_84894 |
---|
Ki | 501±n/a nM |
---|
Citation | Lumma, WC; Anderson, PS; Baldwin, JJ; Bolhofer, WA; Habecker, CN; Hirshfield, JM; Pietruszkiewicz, AM; Randall, WC; Torchiana, ML; Britcher, SF; Clineschmidt, BV; Denny, GH; Hirschmann, R; Hoffman, MJ; Phillips, BT; Streeter, KB Inhibitors of gastric acid secretion: 3,4-diamino-1,2,5-thiadiazole 1-oxides and 1,1-dioxides as urea equivalents in a series of histamine H2-receptor antagonists. J Med Chem25:207-10 (1982) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Histamine H2 receptor |
---|
Name: | Histamine H2 receptor |
Synonyms: | Gastric receptor I | H2R | HISTAMINE H2 | HRH2 | HRH2_CAVPO | Histamine H2-Gs alpha S |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40567.22 |
Organism: | Cavia porcellus (domestic guinea pig) |
Description: | For the H2 receptor-binding assays, guinea pig striatum was used. |
Residue: | 359 |
Sequence: | MAFNGTVPSFCMDFTVYKVTISVILIILILVTVAGNVVVCLAVGLNRRLRSLTNCFIVSL
AVTDLLLGLLVLPFSAIYQLSCKWSFSKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
TDPLRYPVLITPARVAISLVFIWVISITLSFLSIHLGWNSRNETSKDNDTIVKCKVQVNE
VYGLVDGLVTFYLPLLIMCITYFRIFKIAREQARRINHIGSWKAATIREHKATVTLAAVM
GAFIICWFPYFTVFVYRGLKGDDAVNEVFEDVVLWLGYANSALNPILYAALNRDFRTAYH
QLFCCRLASHNSHETSLRLNNSQLNRSQCQEPRWQEDKPLNLQVWSGTEVTAPQGATNR
|
|
|
BDBM22893 |
---|
n/a |
---|
Name | BDBM22893 |
Synonyms: | CHEMBL512 | Ranitidine | ZANTAC | dimethyl[(5-{[(2-{[(E)-1-(methylamino)-2-nitroethenyl]amino}ethyl)sulfanyl]methyl}furan-2-yl)methyl]amine |
Type | Small organic molecule |
Emp. Form. | C13H22N4O3S |
Mol. Mass. | 314.404 |
SMILES | CN\C([CH-][N+]([O-])=O)=[NH+]/CCSCc1ccc(CN(C)C)o1 |
Structure |
|