Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHydroxyacid oxidase 1
LigandBDBM50125793
Substrate/Competitorn/a
Meas. Tech.ChEMBL_71275
IC50 3000±n/a nM
Citation Williams HWEichler ERandall WCRooney CSCragoe EJStreeter KBSchwam HMichelson SRPatchett AATaub D Inhibitors of glycolic acid oxidase. 4-substituted 2,4-dioxobutanoic acid derivatives. J Med Chem 26:1196-200 (1983) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Hydroxyacid oxidase 1
Name:Hydroxyacid oxidase 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:40927.89
Organism:Homo sapiens (Human)
Description:ChEMBL_71275
Residue:370
Sequence:
MLPRLICINDYEQHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAET
DLSTSVLGQRVSMPICVGATAMQRMAHVDGELATVRACQSLGTGMMLSSWATSSIEEVAE
AGPEALRWLQLYIYKDREVTKKLVRQAEKMGYKAIFVTVDTPYLGNRLDDVRNRFKLPPQ
LRMKNFETSTLSFSPEENFGDDSGLAAYVAKAIDPSISWEDIKWLRRLTSLPIVAKGILR
GDDAREAVKHGLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV
LKALALGAKAVFVGRPIVWGLAFQGEKGVQDVLEILKEEFRLAMALSGCQNVKVIDKTLV
RKNPLAVSKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50125793
n/a
NameBDBM50125793
Synonyms:4-(4-Cyclohexyl-phenyl)-2-hydroxy-4-oxo-but-2-enoic acid | CHEMBL16405 | CHEMBL417634
TypeSmall organic molecule
Emp. Form.C16H18O4
Mol. Mass.274.3117
SMILESOC(=O)C(=O)CC(=O)c1ccc(cc1)C1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: