| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM18792 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_55071 |
|---|
| Ki | 17378±n/a nM |
|---|
| Citation |  Hansch, C; Hathaway, BA; Guo, ZR; Selassie, CD; Dietrich, SW; Blaney, JM; Langridge, R; Volz, KW; Kaufman, BT Crystallography, quantitative structure-activity relationships, and molecular graphics in a comparative analysis of the inhibition of dihydrofolate reductase from chicken liver and Lactobacillus casei by 4,6-diamino-1,2-dihydro-2,2-dimethyl-1-(substituted-phenyl)-s-triazine s. J Med Chem27:129-43 (1984) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_LACCA | dhfR | folA |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 18437.08 |
|---|
| Organism: | Lactobacillus casei |
|---|
| Description: | ChEMBL_1357878 |
|---|
| Residue: | 163 |
|---|
| Sequence: | MTAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTN
VVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLA
GSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
|
|
|
|---|
| BDBM18792 |
|---|
| n/a |
|---|
| Name | BDBM18792 |
|---|
| Synonyms: | 1-(4-chlorophenyl)-6,6-dimethyl-1,6-dihydro-1,3,5-triazine-2,4-diamine | CHEMBL747 | Chlorazin | Cycloguanil |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H14ClN5 |
|---|
| Mol. Mass. | 251.715 |
|---|
| SMILES | CC1(C)N=C(N)N=C(N)N1c1ccc(Cl)cc1 |t:3,6| |
|---|
| Structure | 
|
|---|
Search and Browse
