| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50291778 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_53616 |
|---|
| Ki | 23±n/a nM |
|---|
| Citation |  Hansch, C; Hathaway, BA; Guo, ZR; Selassie, CD; Dietrich, SW; Blaney, JM; Langridge, R; Volz, KW; Kaufman, BT Crystallography, quantitative structure-activity relationships, and molecular graphics in a comparative analysis of the inhibition of dihydrofolate reductase from chicken liver and Lactobacillus casei by 4,6-diamino-1,2-dihydro-2,2-dimethyl-1-(substituted-phenyl)-s-triazine s. J Med Chem27:129-43 (1984) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | 1.5.1.3 | DHFR | DYR_CHICK |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 21652.69 |
|---|
| Organism: | Gallus gallus (Chicken) |
|---|
| Description: | n/a |
|---|
| Residue: | 189 |
|---|
| Sequence: | VRSLNSIVAVCQNMGIGKDGNLPWPPLRNEYKYFQRMTSTSHVEGKQNAVIMGKKTWFSI
PEKNRPLKDRINIVLSRELKEAPKGAHYLSKSLDDALALLDSPELKSKVDMVWIVGGTAV
YKAAMEKPINHRLFVTRILHEFESDTFFPEIDYKDFKLLTEYPGVPADIQEEDGIQYKFE
VYQKSVLAQ
|
|
|
|---|
| BDBM50291778 |
|---|
| n/a |
|---|
| Name | BDBM50291778 |
|---|
| Synonyms: | CHEMBL20812 | N-{3-[3-(4,6-Diamino-2,2-dimethyl-2H-[1,3,5]triazin-1-yl)-benzyloxy]-phenyl}-acetamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H24N6O2 |
|---|
| Mol. Mass. | 380.4436 |
|---|
| SMILES | CC(=O)Nc1cccc(OCc2cccc(c2)N2C(N)=NC(N)=NC2(C)C)c1 |c:20,23| |
|---|
| Structure | 
|
|---|
Search and Browse
