Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydrofolate reductase
LigandBDBM50291768
Substrate/Competitorn/a
Meas. Tech.ChEBML_55071
Ki 174±n/a nM
Citation Hansch CHathaway BAGuo ZRSelassie CDDietrich SWBlaney JMLangridge RVolz KWKaufman BT Crystallography, quantitative structure-activity relationships, and molecular graphics in a comparative analysis of the inhibition of dihydrofolate reductase from chicken liver and Lactobacillus casei by 4,6-diamino-1,2-dihydro-2,2-dimethyl-1-(substituted-phenyl)-s-triazine s. J Med Chem 27:129-43 (1984) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Dihydrofolate reductase
Name:Dihydrofolate reductase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:18437.08
Organism:Lactobacillus casei
Description:ChEMBL_1357878
Residue:163
Sequence:
MTAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTN
VVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLA
GSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50291768
n/a
NameBDBM50291768
Synonyms:6,6-Dimethyl-1-(3-phenylselanylmethyl-phenyl)-1,6-dihydro-[1,3,5]triazine-2,4-diamine | CHEMBL20224
TypeSmall organic molecule
Emp. Form.C18H21N5Se
Mol. Mass.386.35
SMILESCC1(C)N=C(N)N=C(N)N1c1cccc(C[Se]c2ccccc2)c1 |t:3,6|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: