Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydrofolate reductase
LigandBDBM50291802
Substrate/Competitorn/a
Meas. Tech.ChEBML_53616
Ki 54±n/a nM
Citation Hansch CHathaway BAGuo ZRSelassie CDDietrich SWBlaney JMLangridge RVolz KWKaufman BT Crystallography, quantitative structure-activity relationships, and molecular graphics in a comparative analysis of the inhibition of dihydrofolate reductase from chicken liver and Lactobacillus casei by 4,6-diamino-1,2-dihydro-2,2-dimethyl-1-(substituted-phenyl)-s-triazine s. J Med Chem 27:129-43 (1984) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Dihydrofolate reductase
Name:Dihydrofolate reductase
Synonyms:1.5.1.3 | DHFR
Type:n/a
Mol. Mass.:21652.69
Organism:Gallus gallus (Chicken)
Description:n/a
Residue:189
Sequence:
VRSLNSIVAVCQNMGIGKDGNLPWPPLRNEYKYFQRMTSTSHVEGKQNAVIMGKKTWFSI
PEKNRPLKDRINIVLSRELKEAPKGAHYLSKSLDDALALLDSPELKSKVDMVWIVGGTAV
YKAAMEKPINHRLFVTRILHEFESDTFFPEIDYKDFKLLTEYPGVPADIQEEDGIQYKFE
VYQKSVLAQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50291802
n/a
NameBDBM50291802
Synonyms:1-[3-(3-Ethyl-phenoxymethyl)-phenyl]-6,6-dimethyl-1,6-dihydro-[1,3,5]triazine-2,4-diamine | CHEMBL282932
TypeSmall organic molecule
Emp. Form.C20H25N5O
Mol. Mass.351.4454
SMILESCCc1cccc(OCc2cccc(c2)N2C(N)=NC(N)=NC2(C)C)c1 |c:18,21|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: