Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M3
LigandBDBM50405754
Substrate/Competitorn/a
Meas. Tech.ChEMBL_138522
Kd 3890±n/a nM
Citation Melchiorre CQuaglia WPicchio MTGiardinà DBrasili LAngeli P Structure-activity relationships among methoctramine-related polymethylene tetraamines. Chain-length and substituent effects on M-2 muscarinic receptor blocking activity. J Med Chem 32:79-84 (1989) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M3
Name:Muscarinic acetylcholine receptor M3
Synonyms:GPM3 | Muscarinic acetylcholine receptor
Type:n/a
Mol. Mass.:66272.13
Organism:Cavia porcellus
Description:n/a
Residue:587
Sequence:
MTLHSNSTTLPLFPNISTSWIHSPSEAGLPPGTVTHFGSYNISQAAGNFSSLNGTTSDPL
GGHTIWQVVFIAFLTGFLALVTIIGNILVIVSFKVNKQLKHVNNYFLLSLADLIIGVISM
NLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTT
KRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYM
PVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSLKH
SSRRKYSRCHFWFATKSWKPNAGQMDQDHSSSDSWNNYDAAASLENSASDEEDIGSETRA
IYSIVLKLPGHSTILNSTKLPSSDNLQVPEEDLEPMDMERNASKPQTQKSMDDGGSFQKS
FSNLPIQLESTMDTAKTSDANSSVSKTMATLPLSFKEATLAKRFALRTRSQITKRKRMSL
IKEKRAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNPVC
YALCNKTFRNTFKMLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50405754
n/a
NameBDBM50405754
Synonyms:CHEMBL354855
TypeSmall organic molecule
Emp. Form.C36H62N4O2
Mol. Mass.582.9031
SMILESCOc1cccc(CNCCCCCCNCCCCCCCCNCCCCCCNCc2cccc(OC)c2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: