Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin 1d (5-HT1d) receptor
LigandBDBM50406754
Substrate/Competitorn/a
Meas. Tech.ChEBML_1965
IC50 1.6±n/a nM
Citation Street LJBaker RCastro JLChambers MSGuiblin ARHobbs SCMatassa VGReeve AJBeer MSMiddlemiss DN Synthesis and serotonergic activity of 5-(oxadiazolyl)tryptamines: potent agonists for 5-HT1D receptors. J Med Chem 36:1529-38 (1993) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Serotonin 1d (5-HT1d) receptor
Name:Serotonin 1d (5-HT1d) receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:32680.56
Organism:Sus scrofa
Description:ChEMBL_1963
Residue:291
Sequence:
AMTDLLVSILVMPISIPYTITQTWSFGQLLCDIWLSSDITCCTASILHLCVIALDRYWAI
TDALEYSKRRTAGHAAAMIAIVWAISICISIPPLFWRQARAHEEISDCLVNTSQISYTIY
STCGAFYIPSLLLIILYGRIYRAARNRILNPPSLYGKRFTTAHLITGSAGSSLCSLNPSL
HEGHSHSAGSPLFFNHVKIKLADSVLERKRISAARERKATKTLGIILGAFIICWLPFFVA
SLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFNEEFRQAFQKVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50406754
n/a
NameBDBM50406754
Synonyms:CHEMBL37629
TypeSmall organic molecule
Emp. Form.C22H24N4O
Mol. Mass.360.4522
SMILESNCCc1c[nH]c2ccc(CCCc3nc(Cc4ccccc4)no3)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: