| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
|---|
| Ligand | BDBM50057498 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_204884 (CHEMBL857530) |
|---|
| Ki | >2500±n/a nM |
|---|
| Citation |  Holt, DA; Yamashita, DS; Konialian-Beck, AL; Luengo, JI; Abell, AD; Bergsma, DJ; Brandt, M; Levy, MA Benzophenone- and indolecarboxylic acids: potent type-2 specific inhibitors of human steroid 5 alpha-reductase. J Med Chem38:13-5 (1995) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
|---|
| Name: | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
|---|
| Synonyms: | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 | 5α-Reductase 1 (5α-R1) | S5A1_HUMAN | S5AR | SR type 1 | SRD5A1 | Steroid 5-alpha-reductase | Steroid 5-alpha-reductase 1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 29472.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P18405 |
|---|
| Residue: | 259 |
|---|
| Sequence: | MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQE
LPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMA
IMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGD
TGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWY
LRKFEEYPKFRKIIIPFLF
|
|
|
|---|
| BDBM50057498 |
|---|
| n/a |
|---|
| Name | BDBM50057498 |
|---|
| Synonyms: | 5-Benzyloxy-1H-indole-2-carboxylic acid | CHEMBL24850 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H13NO3 |
|---|
| Mol. Mass. | 267.2793 |
|---|
| SMILES | OC(=O)c1cc2cc(OCc3ccccc3)ccc2[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
