Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin 1d (5-HT1d) receptor
LigandBDBM21392
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1958
IC50 3.98±n/a nM
Citation Street LJBaker RDavey WBGuiblin ARJelley RAReeve AJRoutledge HSternfeld FWatt APBeer MS Synthesis and serotonergic activity of N,N-dimethyl-2-[5-(1,2,4-triazol-1-ylmethyl)-1H-indol-3-yl]ethylamine and analogues: potent agonists for 5-HT1D receptors. J Med Chem 38:1799-810 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Serotonin 1d (5-HT1d) receptor
Name:Serotonin 1d (5-HT1d) receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:32680.56
Organism:Sus scrofa
Description:ChEMBL_1963
Residue:291
Sequence:
AMTDLLVSILVMPISIPYTITQTWSFGQLLCDIWLSSDITCCTASILHLCVIALDRYWAI
TDALEYSKRRTAGHAAAMIAIVWAISICISIPPLFWRQARAHEEISDCLVNTSQISYTIY
STCGAFYIPSLLLIILYGRIYRAARNRILNPPSLYGKRFTTAHLITGSAGSSLCSLNPSL
HEGHSHSAGSPLFFNHVKIKLADSVLERKRISAARERKATKTLGIILGAFIICWLPFFVA
SLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFNEEFRQAFQKVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21392
n/a
NameBDBM21392
Synonyms:3-(2-aminoethyl)-1H-indole-5-carboxamide | 5-CT | 5-CT,DP | 5-carboxamidotryptamine | CHEMBL1256863 | CHEMBL18840 | [3H]-5-CT | [3H]-5-Carboxamide tryptamine | [3H]-5-Carboxyamidotryptamine | [3H]-5-carboxamidotryptamine
TypeSmall organic molecule
Emp. Form.C11H13N3O
Mol. Mass.203.2404
SMILESNCCc1c[nH]c2ccc(cc12)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: