Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHRH3
LigandBDBM22888
Substrate/Competitorn/a
Meas. Tech.ChEMBL_83476
Kd 100±n/a nM
Citation Vollinga RCMenge WMLeurs RTimmerman H New analogs of burimamide as potent and selective histamine H3 receptor antagonists: the effect of chain length variation of the alkyl spacer and modifications of the N-thiourea substituent. J Med Chem 38:2244-50 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
HRH3
Name:Histamine H3 receptor
Synonyms:HISTAMINE H3 | Histamine H3 receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:48753.61
Organism:GUINEA PIG
Description:HISTAMINE H3 HRH3 GUINEA PIG::Q9JI35
Residue:445
Sequence:
MERAPPDGLMNASGALAGEAAAAAGGARTFSAAWTAVLAALMALLIVATVLGNALVMLAF
VADSSLRTQNNFFLLNLAISDFLVGVFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCT
SSVFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMVLVWVLAFLLYGPAILSWEYLSG
GSSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGGARE
AGPDPLPEAQSSPPQPPPGCWGCWPKGQGESMPLHRYGVGEAGPGAEAGEAALGGGSGAA
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSITQRFRLSRDKKVAKSL
AIIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHYSFR
RAFTKLLCPQKLKVQPHSSLEHCWK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22888
n/a
NameBDBM22888
Synonyms:1-[4-(1H-imidazol-5-yl)butyl]-3-methylthiourea | Burimamide | CHEMBL12160
TypeSmall organic molecule
Emp. Form.C9H16N4S
Mol. Mass.212.315
SMILESCNC(=S)NCCCCc1cnc[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: