Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydrofolate Reductase (DHFR)
LigandBDBM50407516
Substrate/Competitorn/a
Meas. Tech.ChEMBL_54221
IC50 26±n/a nM
Citation Chan JHHong JSKuyper LFBaccanari DPJoyner SSTansik RLBoytos CMRudolph SK Selective inhibitors of Candida albicans dihydrofolate reductase: activity and selectivity of 5-(arylthio)-2,4-diaminoquinazolines. J Med Chem 38:3608-16 (1995) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Dihydrofolate Reductase (DHFR)
Name:Dihydrofolate Reductase (DHFR)
Synonyms:Tetrahydrofolate dehydrogenase
Type:Enzyme
Mol. Mass.:22141.77
Organism:Candida albicans
Description:C. albicans DHFR was expressed in E. coli BL21, and purified to homogeneity.
Residue:192
Sequence:
MSKPNVAIIVAALKPALGIGYKGKMPWRLRKEIRYFKDVTTRTTKPNTRNAVIMGRKTWE
SIPQKFRPLPDRLNIILSRSYENKIIDDNIIHASSIESSLNLVSDVERVFIIGGAEIYNE
LINNSLVSHLLITEIEHPSPESIEMDTFLKFPLESWTKQPKSELQKFVGDTVLEDDIKEG
DFTYNYTLWTRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50407516
n/a
NameBDBM50407516
Synonyms:CHEMBL121057
TypeSmall organic molecule
Emp. Form.C19H20N4O2S
Mol. Mass.368.453
SMILESNc1nc(N)c2c(Sc3ccc(OC4CCOCC4)cc3)cccc2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: