Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Ligand | BDBM50408097 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_66276 (CHEMBL857528) |
---|
Ki | 7200±n/a nM |
---|
Citation | Dragovich, PS; Barker, JE; French, J; Imbacuan, M; Kalish, VJ; Kissinger, CR; Knighton, DR; Lewis, CT; Moomaw, EW; Parge, HE; Pelletier, LA; Prins, TJ; Showalter, RE; Tatlock, JH; Tucker, KD; Villafranca, JE Structure-based design of novel, urea-containing FKBP12 inhibitors. J Med Chem39:1872-84 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
Synonyms: | 12 kDa FK506-binding protein | 12 kDa FKBP | FK506-binding protein 1A | FK506-binding protein 1A (FKBP12) | FKB1A_HUMAN | FKBP-12 | FKBP-1A | FKBP1 | FKBP12 | FKBP1A | Immunophilin FKBP12 | PPIase | PPIase FKBP1A | Peptidyl-prolyl cis-trans isomerase (FKBP) | Rotamase | RyR1/FKBP12 | mTOR/FKBP12A/FKBP12B |
Type: | Isomerase |
Mol. Mass.: | 11953.09 |
Organism: | Homo sapiens (Human) |
Description: | P62942 |
Residue: | 108 |
Sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
|
|
|
BDBM50408097 |
---|
n/a |
---|
Name | BDBM50408097 |
Synonyms: | CHEMBL56270 |
Type | Small organic molecule |
Emp. Form. | C18H24N2O3 |
Mol. Mass. | 316.3948 |
SMILES | CC(=C)CNC(=O)N1CCCC[C@H]1C(=O)OCc1ccccc1 |
Structure |
|