Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M4
LigandBDBM50408530
Substrate/Competitorn/a
Meas. Tech.ChEMBL_139256
Ki 42±n/a nM
Citation Bolognesi MLMinarini ABudriesi RCacciaguerra SChiarini ASpampinato STumiatti VMelchiorre C Universal template approach to drug design: polyamines as selective muscarinic receptor antagonists. J Med Chem 41:4150-60 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M4
Name:Muscarinic acetylcholine receptor
Synonyms:Cholinergic, muscarinic M4
Type:Enzyme Catalytic Domain
Mol. Mass.:52841.70
Organism:RAT
Description:Cholinergic, muscarinic M4 CHRM4 RAT::P08485
Residue:477
Sequence:
MNFTPVNGSSANQSVRLVTAAHNHLETVEMVFIATVTGSLSLVTVVGNILVMLSIKVNRQ
LQTVNNYFLFSLGCADLIIGAFSMNLYTLYIIKGYWPLGAVVCDLWLALDYVVSNASVMN
LLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTVPD
NQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVHKHRPEGPKEKKAKTL
AFLKSPLMKPSIKKPPPGGASREELRNGKLEEAPPPALPPPPRPVPDKDTSNESSSGSAT
QNTKERPPTELSTAEATTPALPAPTLQPRTLNPASKWSKIQIVTKQTGNECVTAIEIVPA
TPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMVLV
NTFCQSCIPERVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50408530
n/a
NameBDBM50408530
Synonyms:CHEMBL1202003
TypeSmall organic molecule
Emp. Form.C67H80N10O6
Mol. Mass.1121.4155
SMILESCN(CCCCCCCCN(C)CCCCCCN(CC(=O)N1c2ccccc2NC(=O)c2ccccc12)CC(=O)N1c2ccccc2NC(=O)c2ccccc12)CCCCCCNCC(=O)N1c2ccccc2NC(=O)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: