Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M2
LigandBDBM50408530
Substrate/Competitorn/a
Meas. Tech.ChEMBL_138172
Ki 0.44±n/a nM
Citation Bolognesi MLMinarini ABudriesi RCacciaguerra SChiarini ASpampinato STumiatti VMelchiorre C Universal template approach to drug design: polyamines as selective muscarinic receptor antagonists. J Med Chem 41:4150-60 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M2
Name:Muscarinic receptor M2 and M3
Synonyms:CHRM2 | Cholinergic, muscarinic M2
Type:Enzyme Catalytic Domain
Mol. Mass.:51555.53
Organism:RAT
Description:P10980
Residue:466
Sequence:
MNNSTNSSNNGLAITSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKEKKEPVANQDPVSPSLVQGRI
VKPNNNNMPGGDGGLEHNKIQNGKAPRDGVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSRDDNSKQTCIKIVTKAQKGDVCTPTSTTVELVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50408530
n/a
NameBDBM50408530
Synonyms:CHEMBL1202003
TypeSmall organic molecule
Emp. Form.C67H80N10O6
Mol. Mass.1121.4155
SMILESCN(CCCCCCCCN(C)CCCCCCN(CC(=O)N1c2ccccc2NC(=O)c2ccccc12)CC(=O)N1c2ccccc2NC(=O)c2ccccc12)CCCCCCNCC(=O)N1c2ccccc2NC(=O)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: