Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M3
LigandBDBM50408535
Substrate/Competitorn/a
Meas. Tech.ChEMBL_138975
Ki 3±n/a nM
Citation Bolognesi MLMinarini ABudriesi RCacciaguerra SChiarini ASpampinato STumiatti VMelchiorre C Universal template approach to drug design: polyamines as selective muscarinic receptor antagonists. J Med Chem 41:4150-60 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M3
Name:Muscarinic receptor M2 and M3
Synonyms:Cholinergic, muscarinic M3
Type:Enzyme Catalytic Domain
Mol. Mass.:66086.66
Organism:RAT
Description:Cholinergic, muscarinic M3 CHRM3 RAT::P08483
Residue:589
Sequence:
MTLHSNSTTSPLFPNISSSWVHSPSEAGLPLGTVTQLGSYNISQETGNFSSNDTSSDPLG
GHTIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVIS
MNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRT
TKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFY
MPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVHPTGSSRSCSSYELQQQGVK
RSSRRKYGRCHFWFTTKSWKPSAEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSET
RAIYSIVLKLPGHSSILNSTKLPSSDNLQVSNEDLGTVDVERNAHKLQAQKSMGDGDNCQ
KDFTKLPIQLESAVDTGKTSDTNSSADKTTATLPLSFKEATLAKRFALKTRSQITKRKRM
SLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNP
VCYALCNKTFRTTFKTLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50408535
n/a
NameBDBM50408535
Synonyms:CHEMBL131865
TypeSmall organic molecule
Emp. Form.C38H63N7O2
Mol. Mass.649.9525
SMILESCN(CCCCCCN)CCCCCCCCN(C)CCCCCCNCCCC(=O)N1c2ccccc2C(=O)Nc2cccnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: