Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin K
LigandBDBM50066650
Substrate/Competitorn/a
Meas. Tech.ChEMBL_48328
Ki 22±n/a nM
Citation LaLonde JMZhao BSmith WWJanson CADesJarlais RLTomaszek TACarr TJThompson SKOh HJYamashita DSVeber DFAbdel-Meguid SS Use of papain as a model for the structure-based design of cathepsin K inhibitors: crystal structures of two papain-inhibitor complexes demonstrate binding to S'-subsites. J Med Chem 41:4567-76 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin K
Name:Cathepsin K
Synonyms:CTSK | CTSO | CTSO2 | Cathepsin O | Cathepsin O2 | Cathepsin X
Type:Enzyme
Mol. Mass.:36975.68
Organism:Homo sapiens (Human)
Description:P43235
Residue:329
Sequence:
MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIH
NLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVD
YRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGG
YMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVA
RVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGE
NWGNKGYILMARNKNNACGIANLASFPKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50066650
n/a
NameBDBM50066650
Synonyms:1,3-BIS[[N-[(PHENYLMETHOXY)CARBONYL]-L-LEUCYL]AMINO]-2-PROPANONE | CHEMBL281540 | {(S)-1-[3-((S)-2-Benzyloxycarbonylamino-4-methyl-pentanoylamino)-2-oxo-propylcarbamoyl]-3-methyl-butyl}-carbamic acid benzyl ester | {1-[3-(2-Benzyloxycarbonylamino-4-methyl-pentanoylamino)-2-oxo-propylcarbamoyl]-3-methyl-butyl}-carbamic acid benzyl ester
TypeSmall organic molecule
Emp. Form.C31H42N4O7
Mol. Mass.582.6878
SMILESCC(C)C[C@H](NC(=O)OCc1ccccc1)C(=O)NCC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)OCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: