Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 1B |
---|
Ligand | BDBM50408700 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1383 (CHEMBL616455) |
---|
Ki | 2.51±n/a nM |
---|
Citation | Gaster, LM; Blaney, FE; Davies, S; Duckworth, DM; Ham, P; Jenkins, S; Jennings, AJ; Joiner, GF; King, FD; Mulholland, KR; Wyman, PA; Hagan, JJ; Hatcher, J; Jones, BJ; Middlemiss, DN; Price, GW; Riley, G; Roberts, C; Routledge, C; Selkirk, J; Slade, PD The selective 5-HT1B receptor inverse agonist 1'-methyl-5-[[2'-methyl-4'-(5-methyl-1,2, 4-oxadiazol-3-yl)biphenyl-4-yl]carbonyl]-2,3,6,7-tetrahydro- spiro[furo[2,3-f]indole-3,4'-piperidine] (SB-224289) potently blocks terminal 5-HT autoreceptor function both in vitro and in vivo. J Med Chem41:1218-35 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5-hydroxytryptamine receptor 1B |
---|
Name: | 5-hydroxytryptamine receptor 1B |
Synonyms: | 5-HT-1B | 5-HT-1D-beta | 5-HT1B | 5-hydroxytryptamine receptor 1B (5-HT1B) | 5HT1B_HUMAN | HTR1B | HTR1DB | S12 | Serotonin (5-HT) receptor | Serotonin 1D beta receptor | Serotonin Receptor 1B |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 43579.17 |
Organism: | Homo sapiens (Human) |
Description: | Receptor binding assays were performed using human clone stably expressed in CHO cells |
Residue: | 390 |
Sequence: | MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT
LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV
VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI
SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL
KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL
NSLINPIIYTMSNEDFKQAFHKLIRFKCTS
|
|
|
BDBM50408700 |
---|
n/a |
---|
Name | BDBM50408700 |
Synonyms: | CHEMBL282693 |
Type | Small organic molecule |
Emp. Form. | C28H31N5O3 |
Mol. Mass. | 485.5774 |
SMILES | COc1ccc(NC(=O)c2ccc(cc2)-c2ccc(cc2C)-c2noc(C)n2)cc1NCCN(C)C |
Structure |
|