Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM22032 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_37806 (CHEMBL651181) |
---|
IC50 | 1.41±n/a nM |
---|
Citation | Trapani, G; Franco, M; Latrofa, A; Ricciardi, L; Carotti, A; Serra, M; Sanna, E; Biggio, G; Liso, G Novel 2-phenylimidazo[1,2-a]pyridine derivatives as potent and selective ligands for peripheral benzodiazepine receptors: synthesis, binding affinity, and in vivo studies. J Med Chem42:3934-41 (1999) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM22032 |
---|
n/a |
---|
Name | BDBM22032 |
Synonyms: | 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxamide | CHEMBL15313 | N-(butan-2-yl)-1-(2-chlorophenyl)-N-methylisoquinoline-3-carboxamide | PK 11195 | PK-11195 | PK11195 | RP 52028 | [3H]PK 11195 |
Type | radiolabeled ligand |
Emp. Form. | C21H21ClN2O |
Mol. Mass. | 352.857 |
SMILES | CCC(C)N(C)C(=O)c1cc2ccccc2c(n1)-c1ccccc1Cl |
Structure |
|