| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50060115 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_37806 (CHEMBL651181) |
|---|
| IC50 | 1.62±n/a nM |
|---|
| Citation |  Trapani, G; Franco, M; Latrofa, A; Ricciardi, L; Carotti, A; Serra, M; Sanna, E; Biggio, G; Liso, G Novel 2-phenylimidazo[1,2-a]pyridine derivatives as potent and selective ligands for peripheral benzodiazepine receptors: synthesis, binding affinity, and in vivo studies. J Med Chem42:3934-41 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM50060115 |
|---|
| n/a |
|---|
| Name | BDBM50060115 |
|---|
| Synonyms: | 2-(6-Bromo-8-methyl-2-phenyl-imidazo[1,2-a]pyridin-3-yl)-N,N-dipropyl-acetamide | CHEMBL321916 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H26BrN3O |
|---|
| Mol. Mass. | 428.365 |
|---|
| SMILES | CCCN(CCC)C(=O)Cc1c(nc2c(C)cc(Br)cn12)-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
