Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistidine-rich protein
LigandBDBM50408770
Substrate/Competitorn/a
Meas. Tech.ChEMBL_155111
IC50 17000±n/a nM
Citation Vippagunta SRDorn AMatile HBhattacharjee AKKarle JMEllis WYRidley RGVennerstrom JL Structural specificity of chloroquine-hematin binding related to inhibition of hematin polymerization and parasite growth. J Med Chem 42:4630-9 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Histidine-rich protein
Name:Histidine-rich protein
Synonyms:Histidine-rich protein PFHRP-II
Type:PROTEIN
Mol. Mass.:35156.49
Organism:Plasmodium falciparum
Description:ChEMBL_500704
Residue:332
Sequence:
MVSFSKNKVLSAAVFASVLLLDNNNSAFNNNLCSKNAKGLNLNKRLLHETQAHVDDAHHA
HHVADAHHAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHA
ADAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHAAYAHHAHHASDAHHAADAHHAAYA
HHAHHAADAHHAADAHHAAYAHHAHHAADAHHAADAHHATDAHHAHHAADAHHATDAHHA
ADAHHAADAHHATDAHHAADAHHATDAHHAADAHHAADAHHATDSHHAHHAADAHHAAAH
HATDAHHAAAHHATDAHHAAAHHEAATHCLRH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50408770
n/a
NameBDBM50408770
Synonyms:CHEMBL143042 | TCMDC-124246
TypeSmall organic molecule
Emp. Form.C19H28ClN3
Mol. Mass.333.899
SMILESCCN(CC)CCCC(C)Nc1cc(C)nc2cc(Cl)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: