| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50455439 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_158030 (CHEMBL768621) |
|---|
| IC50 | 146±n/a nM |
|---|
| Citation |  Vieth, M; Cummins, DJ DoMCoSAR: a novel approach for establishing the docking mode that is consistent with the structure-activity relationship. Application to HIV-1 protease inhibitors and VEGF receptor tyrosine kinase inhibitors. J Med Chem43:3020-32 (2000) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50455439 |
|---|
| n/a |
|---|
| Name | BDBM50455439 |
|---|
| Synonyms: | CHEMBL2367852 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H40N2O4 |
|---|
| Mol. Mass. | 516.671 |
|---|
| SMILES | [H][C@](C)(NC(=O)[C@]([H])(Cc1ccccc1)C[C@]([H])(O)[C@]([H])(Cc1ccccc1)NC(=O)OC(C)(C)C)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
