Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistidine-rich protein
LigandBDBM22985
Substrate/Competitorn/a
Meas. Tech.ChEMBL_149254
IC50 38000±n/a nM
Citation Stocks PARaynes KJBray PGPark BKO'Neill PMWard SA Novel short chain chloroquine analogues retain activity against chloroquine resistant K1 Plasmodium falciparum. J Med Chem 45:4975-83 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Histidine-rich protein
Name:Histidine-rich protein
Synonyms:Histidine-rich protein PFHRP-II
Type:PROTEIN
Mol. Mass.:35156.49
Organism:Plasmodium falciparum
Description:ChEMBL_500704
Residue:332
Sequence:
MVSFSKNKVLSAAVFASVLLLDNNNSAFNNNLCSKNAKGLNLNKRLLHETQAHVDDAHHA
HHVADAHHAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHA
ADAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHAAYAHHAHHASDAHHAADAHHAAYA
HHAHHAADAHHAADAHHAAYAHHAHHAADAHHAADAHHATDAHHAHHAADAHHATDAHHA
ADAHHAADAHHATDAHHAADAHHATDAHHAADAHHAADAHHATDSHHAHHAADAHHAAAH
HATDAHHAAAHHATDAHHAAAHHEAATHCLRH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22985
n/a
NameBDBM22985
Synonyms:Aralen | CHEMBL76 | CHLOROQUINE PHOSPHATE | Chlorochin | Chloroquine | Chloroquine, 17 | {4-[(7-chloroquinolin-4-yl)amino]pentyl}diethylamine
TypeAntimalarial
Emp. Form.C18H26ClN3
Mol. Mass.319.872
SMILESCCN(CC)CCCC(C)Nc1ccnc2cc(Cl)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: